TNFSF15 (Human) Recombinant Protein
  • TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein

Ref: AB-P6416
TNFSF15 (Human) Recombinant Protein

Información del producto

Human TNFSF15 (O95150) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq QLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 9966

Enviar un mensaje


TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein