TFF3 (Human) Recombinant Protein
  • TFF3 (Human) Recombinant Protein

TFF3 (Human) Recombinant Protein

Ref: AB-P6410
TFF3 (Human) Recombinant Protein

Información del producto

Human TFF3 (Q07654) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name TFF3
Gene Alias HITF|ITF|TFI|hP1.B
Gene Description trefoil factor 3 (intestinal)
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 7033

Enviar un mensaje


TFF3 (Human) Recombinant Protein

TFF3 (Human) Recombinant Protein