TFF1 (Human) Recombinant Protein
  • TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein

Ref: AB-P6408
TFF1 (Human) Recombinant Protein

Información del producto

Human TFF1 (P04155) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name TFF1
Gene Alias BCEI|D21S21|HP1.A|HPS2|pNR-2|pS2
Gene Description trefoil factor 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 7031

Enviar un mensaje


TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein