TNFRSF13B (Human) Recombinant Protein
  • TNFRSF13B (Human) Recombinant Protein

TNFRSF13B (Human) Recombinant Protein

Ref: AB-P6406
TNFRSF13B (Human) Recombinant Protein

Información del producto

Human TNFRSF13B (O14836) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name TNFRSF13B
Gene Alias CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B
Gene Description tumor necrosis factor receptor superfamily, member 13B
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 23495

Enviar un mensaje


TNFRSF13B (Human) Recombinant Protein

TNFRSF13B (Human) Recombinant Protein