CLCF1 (Human) Recombinant Protein
  • CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein

Ref: AB-P6379
CLCF1 (Human) Recombinant Protein

Información del producto

Human CLCF1 (Q9UBD9) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name CLCF1
Gene Alias BSF3|CISS2|CLC|NNT1|NR6
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 23529

Enviar un mensaje


CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein