MSLN (Human) Recombinant Protein
  • MSLN (Human) Recombinant Protein

MSLN (Human) Recombinant Protein

Ref: AB-P6375
MSLN (Human) Recombinant Protein

Información del producto

Human MSLN (Q13421) recombinant protein expressed in E. Coli.
Información adicional
Size 50 ug
Gene Name MSLN
Gene Alias CAK1|MPF|SMR
Gene Description mesothelin
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPER
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 10232

Enviar un mensaje


MSLN (Human) Recombinant Protein

MSLN (Human) Recombinant Protein