ARMETL1 (Human) Recombinant Protein
  • ARMETL1 (Human) Recombinant Protein

ARMETL1 (Human) Recombinant Protein

Ref: AB-P6343
ARMETL1 (Human) Recombinant Protein

Información del producto

Human ARMETL1 (Q49AH0) recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name ARMETL1
Gene Alias cdnf
Gene Description arginine-rich, mutated in early stage tumors-like 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 441549

Enviar un mensaje


ARMETL1 (Human) Recombinant Protein

ARMETL1 (Human) Recombinant Protein