Ver mas grande
ARMETL1 (Human) Recombinant Protein
AB-P6343
Producto nuevo
ARMETL1 (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ARMETL1 |
| Gene Alias | cdnf |
| Gene Description | arginine-rich, mutated in early stage tumors-like 1 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 441549 |
Más información
Human ARMETL1 (Q49AH0) recombinant protein expressed in CHO cells.