CD14 (Human) Recombinant Protein
  • CD14 (Human) Recombinant Protein

CD14 (Human) Recombinant Protein

Ref: AB-P6339
CD14 (Human) Recombinant Protein

Información del producto

Human CD14 (P08571) recombinant protein expressed in CHO cells.
Información adicional
Size 250 ug
Gene Name CD14
Gene Alias -
Gene Description CD14 molecule
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 929

Enviar un mensaje


CD14 (Human) Recombinant Protein

CD14 (Human) Recombinant Protein