CXCL14 (Human) Recombinant Protein
  • CXCL14 (Human) Recombinant Protein

CXCL14 (Human) Recombinant Protein

Ref: AB-P6336
CXCL14 (Human) Recombinant Protein

Información del producto

Human CXCL14 (O95715) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name CXCL14
Gene Alias BMAC|BRAK|KS1|Kec|MGC10687|MIP-2g|NJAC|SCYB14|bolekine
Gene Description chemokine (C-X-C motif) ligand 14
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 9547

Enviar un mensaje


CXCL14 (Human) Recombinant Protein

CXCL14 (Human) Recombinant Protein