ANGPTL7 (Human) Recombinant Protein
  • ANGPTL7 (Human) Recombinant Protein

ANGPTL7 (Human) Recombinant Protein

Ref: AB-P6328
ANGPTL7 (Human) Recombinant Protein

Información del producto

Human ANGPTL7 (O43827) recombinant protein expressed in CHO cells.
Información adicional
Size 20 ug
Gene Name ANGPTL7
Gene Alias AngX|CDT6|RP4-647M16.2|dJ647M16.1
Gene Description angiopoietin-like 7
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNC
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 10218

Enviar un mensaje


ANGPTL7 (Human) Recombinant Protein

ANGPTL7 (Human) Recombinant Protein