INHBB (Human) Recombinant Protein
  • INHBB (Human) Recombinant Protein

INHBB (Human) Recombinant Protein

Ref: AB-P6324
INHBB (Human) Recombinant Protein

Información del producto

Human INHBB (P09529) recombinant protein expressed in CHO cells.
Información adicional
Size 50 ug
Gene Name INHBB
Gene Alias MGC157939
Gene Description inhibin, beta B
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 3625

Enviar un mensaje


INHBB (Human) Recombinant Protein

INHBB (Human) Recombinant Protein