sspA (iStaphylococcus aureus/i) Recombinant Protein
Ref: AB-P6305
sspA (Staphylococcus aureus) Recombinant Protein
Información del producto
Staphylococcus aureus sspA (P0C1U8) recombinant protein expressed in E.Coli.
Información adicional
Size
250 ug
Storage Conditions
Stored at -20ºC to-80ºC for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.
Aliquot to avoid repeated freezing and thawing.
After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key
WB
Immunogen Prot. Seq
MLPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDN
Form
Lyophilized
Quality control testing
Reducing and Non-Reducing SDS PAGE
Storage Buffer
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID
13875352