Il10 (Rat) Recombinant Protein
  • Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein

Ref: AB-P6299
Il10 (Rat) Recombinant Protein

Información del producto

Rat Il10 (P29456) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il10
Gene Alias IL10X
Gene Description interleukin 10
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 25325

Enviar un mensaje


Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein