Retnlg (Mouse) Recombinant Protein Ver mas grande

Retnlg (Mouse) Recombinant Protein

AB-P6288

Producto nuevo

Retnlg (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.


Hoja técnica

Size 100 ug
Gene Name Retnlg
Gene Alias Fizz3|Relmg|Xcp1
Gene Description resistin like gamma
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 245195

Más información

Mouse Retnlg (Q8K426) recombinant protein expressed in E.Coli.

Consulta sobre un producto

Retnlg (Mouse) Recombinant Protein

Retnlg (Mouse) Recombinant Protein