Il1f9 (Mouse) Recombinant Protein
  • Il1f9 (Mouse) Recombinant Protein

Il1f9 (Mouse) Recombinant Protein

Ref: AB-P6281
Il1f9 (Mouse) Recombinant Protein

Información del producto

Mouse Il1f9 (Q8R460) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il1f9
Gene Alias -
Gene Description interleukin 1 family, member 9
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 10 mM HCl at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 215257

Enviar un mensaje


Il1f9 (Mouse) Recombinant Protein

Il1f9 (Mouse) Recombinant Protein