Cxcl2 (Mouse) Recombinant Protein
  • Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein

Ref: AB-P6280
Cxcl2 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl2 (P34884) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Cxcl2
Gene Alias CINC-2a|GROb|Gro2|MIP-2|MIP-2a|Mgsa-b|Mip2|Scyb|Scyb2
Gene Description chemokine (C-X-C motif) ligand 2
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 20310

Enviar un mensaje


Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein