Il22 (Mouse) Recombinant Protein
  • Il22 (Mouse) Recombinant Protein

Il22 (Mouse) Recombinant Protein

Ref: AB-P6278
Il22 (Mouse) Recombinant Protein

Información del producto

Mouse Il22 (Q9JJY9) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il22
Gene Alias IL-22|IL-TIF|Iltif
Gene Description interleukin 22
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 50929

Enviar un mensaje


Il22 (Mouse) Recombinant Protein

Il22 (Mouse) Recombinant Protein