Egf (Mouse) Recombinant Protein
  • Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein

Ref: AB-P6275
Egf (Mouse) Recombinant Protein

Información del producto

Mouse Egf (P01132) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Storage Prior to Reconstitution: -20C.
Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 13645

Enviar un mensaje


Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein