Il33 (Mouse) Recombinant Protein
  • Il33 (Mouse) Recombinant Protein

Il33 (Mouse) Recombinant Protein

Ref: AB-P6272
Il33 (Mouse) Recombinant Protein

Información del producto

Mouse Il33 (Q8BVZ5) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il33
Gene Alias 9230117N10Rik|Il-33|Il1f11|NF-HEV
Gene Description interleukin 33
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 77125

Enviar un mensaje


Il33 (Mouse) Recombinant Protein

Il33 (Mouse) Recombinant Protein