Ccl21a (Mouse) Recombinant Protein
  • Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein

Ref: AB-P6271
Ccl21a (Mouse) Recombinant Protein

Información del producto

Mouse Ccl21a (P84444) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Ccl21a
Gene Alias 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt
Gene Description chemokine (C-C motif) ligand 21A
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 18829

Enviar un mensaje


Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein