Lep (Mouse) Recombinant Protein
  • Lep (Mouse) Recombinant Protein

Lep (Mouse) Recombinant Protein

Ref: AB-P6268
Lep (Mouse) Recombinant Protein

Información del producto

Mouse Lep (Q544U0) recombinant protein expressed in E.Coli.
Información adicional
Size 200 ug
Gene Name Lep
Gene Alias ob|obese
Gene Description leptin
Storage Conditions Storage Prior to Reconstitution: -20C
After reconstitution with sterile water at 0.1 mg/mL, store at -80C for long term.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 16846

Enviar un mensaje


Lep (Mouse) Recombinant Protein

Lep (Mouse) Recombinant Protein