IFN-alpha 2a (Human) Recombinant Protein Ver mas grande

IFN-alpha 2a (Human) Recombinant Protein

AB-P6259

Producto nuevo

IFN-alpha 2a (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 250 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 3440

Más información

Human IFN-alpha 2a (P01563) recombinant protein expressed in E.Coli.

Consulta sobre un producto

IFN-alpha 2a (Human) Recombinant Protein

IFN-alpha 2a (Human) Recombinant Protein