NTF4 (Human) Recombinant Protein
  • NTF4 (Human) Recombinant Protein

NTF4 (Human) Recombinant Protein

Ref: AB-P6245
NTF4 (Human) Recombinant Protein

Información del producto

Human NTF4 (P34130) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name NTF4
Gene Alias NT-4/5|NT4|NT5|NTF5
Gene Description neurotrophin 4
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 4909

Enviar un mensaje


NTF4 (Human) Recombinant Protein

NTF4 (Human) Recombinant Protein