FLT3LG (Human) Recombinant Protein
  • FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein

Ref: AB-P6240
FLT3LG (Human) Recombinant Protein

Información del producto

Human FLT3LG (P49771) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name FLT3LG
Gene Alias FL
Gene Description fms-related tyrosine kinase 3 ligand
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM NaCl, pH 7.5.
Gene ID 2323

Enviar un mensaje


FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein