TGFA (Human) Recombinant Protein
  • TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein

Ref: AB-P6238
TGFA (Human) Recombinant Protein

Información del producto

Human TGFA (P01135) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 7039

Enviar un mensaje


TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein