RSPO1 (Human) Recombinant Protein
  • RSPO1 (Human) Recombinant Protein

RSPO1 (Human) Recombinant Protein

Ref: AB-P6237
RSPO1 (Human) Recombinant Protein

Información del producto

Human RSPO1 (Q2MKA7) recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name RSPO1
Gene Alias CRISTIN3|FLJ40906|RSPO
Gene Description R-spondin homolog (Xenopus laevis)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing PBS.
Gene ID 284654

Enviar un mensaje


RSPO1 (Human) Recombinant Protein

RSPO1 (Human) Recombinant Protein