IL1RN (Human) Recombinant Protein Ver mas grande

IL1RN (Human) Recombinant Protein

AB-P6226

Producto nuevo

IL1RN (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 3557

Más información

Human IL1RN (P18510) recombinant protein expressed in E.Coli.

Consulta sobre un producto

IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein