AB-P6218
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 ug |
Gene Name | CCL26 |
Gene Alias | IMAC|MGC126714|MIP-4a|MIP-4alpha|SCYA26|TSC-1 |
Gene Description | chemokine (C-C motif) ligand 26 |
Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB |
Immunogen Prot. Seq | TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Form | Lyophilized |
Quality control testing | Reducing and Non-Reducing SDS PAGE |
Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
Gene ID | 10344 |