CX3CL1 (Human) Recombinant Protein
  • CX3CL1 (Human) Recombinant Protein

CX3CL1 (Human) Recombinant Protein

Ref: AB-P6215
CX3CL1 (Human) Recombinant Protein

Información del producto

Human CX3CL1 (P78423) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name CX3CL1
Gene Alias ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin
Gene Description chemokine (C-X3-C motif) ligand 1
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 6376

Enviar un mensaje


CX3CL1 (Human) Recombinant Protein

CX3CL1 (Human) Recombinant Protein