PDGFA (Human) Recombinant Protein Ver mas grande

PDGFA (Human) Recombinant Protein

AB-P6213

Producto nuevo

PDGFA (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.


Hoja técnica

Size 100 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 5154

Más información

Human PDGFA (P04085) recombinant protein expressed in E.Coli.

Consulta sobre un producto

PDGFA (Human) Recombinant Protein

PDGFA (Human) Recombinant Protein