DKK2 (Human) Recombinant Protein
  • DKK2 (Human) Recombinant Protein

DKK2 (Human) Recombinant Protein

Ref: AB-P5865
DKK2 (Human) Recombinant Protein

Información del producto

Human DKK2 (NP_055236, 34 a.a. - 259 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DKK2
Gene Alias DKK-2
Gene Description dickkopf homolog 2 (Xenopus laevis)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (0.4 M Urea, 10% glycerol).
Gene ID 27123

Enviar un mensaje


DKK2 (Human) Recombinant Protein

DKK2 (Human) Recombinant Protein