MCL1 (Human) Recombinant Protein
  • MCL1 (Human) Recombinant Protein

MCL1 (Human) Recombinant Protein

Ref: AB-P5864
MCL1 (Human) Recombinant Protein

Información del producto

Human MCL1 (NP_068779, 1 a.a. - 327 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name MCL1
Gene Alias BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM
Gene Description myeloid cell leukemia sequence 1 (BCL2-related)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKL
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (20% glycerol, 2 mM DTT).
Gene ID 4170

Enviar un mensaje


MCL1 (Human) Recombinant Protein

MCL1 (Human) Recombinant Protein