RHOV (Human) Recombinant Protein
  • RHOV (Human) Recombinant Protein

RHOV (Human) Recombinant Protein

Ref: AB-P5862
RHOV (Human) Recombinant Protein

Información del producto

Human RHOV (NP_598378, 1 a.a. - 236 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name RHOV
Gene Alias ARHV|Chp|WRCH2
Gene Description ras homolog gene family, member V
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKF
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (2 M Urea, 20% glycerol, 1mM DTT).
Gene ID 171177

Enviar un mensaje


RHOV (Human) Recombinant Protein

RHOV (Human) Recombinant Protein