HBA2 (Human) Recombinant Protein
  • HBA2 (Human) Recombinant Protein

HBA2 (Human) Recombinant Protein

Ref: AB-P5858
HBA2 (Human) Recombinant Protein

Información del producto

Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HBA2
Gene Alias -
Gene Description hemoglobin, alpha 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 2 M urea, 2 mM DTT).
Gene ID 3040

Enviar un mensaje


HBA2 (Human) Recombinant Protein

HBA2 (Human) Recombinant Protein