PTGR1 (Human) Recombinant Protein
  • PTGR1 (Human) Recombinant Protein

PTGR1 (Human) Recombinant Protein

Ref: AB-P5854
PTGR1 (Human) Recombinant Protein

Información del producto

Human PTGR1 (NP_036344, 1 a.a. - 329 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PTGR1
Gene Alias LTB4DH|MGC34943|ZADH3
Gene Description prostaglandin reductase 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSEFMVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQM
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 7.5 (10% glycerol, 1 mM DTT).
Gene ID 22949

Enviar un mensaje


PTGR1 (Human) Recombinant Protein

PTGR1 (Human) Recombinant Protein