DHODH (Human) Recombinant Protein
  • DHODH (Human) Recombinant Protein

DHODH (Human) Recombinant Protein

Ref: AB-P5845
DHODH (Human) Recombinant Protein

Información del producto

Human DHODH (NP_001352, 31 a.a. - 395 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name DHODH
Gene Alias DHOdehase
Gene Description dihydroorotate dehydrogenase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMTGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLT
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 1723

Enviar un mensaje


DHODH (Human) Recombinant Protein

DHODH (Human) Recombinant Protein