CCNB2 (Human) Recombinant Protein
  • CCNB2 (Human) Recombinant Protein

CCNB2 (Human) Recombinant Protein

Ref: AB-P5843
CCNB2 (Human) Recombinant Protein

Información del producto

Human CCNB2 (NP_004692, 1 a.a. - 398 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CCNB2
Gene Alias HsT17299
Gene Description cyclin B2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIE
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (50% glycerol, 5 mM DTT).
Gene ID 9133

Enviar un mensaje


CCNB2 (Human) Recombinant Protein

CCNB2 (Human) Recombinant Protein