FABP12 (Human) Recombinant Protein
  • FABP12 (Human) Recombinant Protein

FABP12 (Human) Recombinant Protein

Ref: AB-P5401
FABP12 (Human) Recombinant Protein

Información del producto

Human FABP12 (NP_001098751, 1 a.a. - 140 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name FABP12
Gene Alias -
Gene Description fatty acid binding protein 12
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 7.5 (10% glycerol).
Gene ID 646486

Enviar un mensaje


FABP12 (Human) Recombinant Protein

FABP12 (Human) Recombinant Protein