HSPB2 (Human) Recombinant Protein
  • HSPB2 (Human) Recombinant Protein

HSPB2 (Human) Recombinant Protein

Ref: AB-P5398
HSPB2 (Human) Recombinant Protein

Información del producto

Human HSPB2 (NP_001532, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HSPB2
Gene Alias HSP27|Hs.78846|LOH11CR1K|MGC133245|MKBP
Gene Description heat shock 27kDa protein 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 3316

Enviar un mensaje


HSPB2 (Human) Recombinant Protein

HSPB2 (Human) Recombinant Protein