CD274 (Human) Recombinant Protein
  • CD274 (Human) Recombinant Protein

CD274 (Human) Recombinant Protein

Ref: AB-P5397
CD274 (Human) Recombinant Protein

Información del producto

Human CD274 (NP_054862, 19 a.a. - 238 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD274
Gene Alias B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1
Gene Description CD274 molecule
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 29126

Enviar un mensaje


CD274 (Human) Recombinant Protein

CD274 (Human) Recombinant Protein