PAK4 (Human) Recombinant Protein
  • PAK4 (Human) Recombinant Protein

PAK4 (Human) Recombinant Protein

Ref: AB-P5384
PAK4 (Human) Recombinant Protein

Información del producto

Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PAK4
Gene Alias -
Gene Description p21 protein (Cdc42/Rac)-activated kinase 4
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/ml
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 7 ug protein in SDS-PAGE
Storage Buffer In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Gene ID 10298

Enviar un mensaje


PAK4 (Human) Recombinant Protein

PAK4 (Human) Recombinant Protein