PAK4 (Human) Recombinant Protein Ver mas grande

PAK4 (Human) Recombinant Protein

AB-P5384

Producto nuevo

PAK4 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.


Hoja técnica

Size 10 ug
Gene Name PAK4
Gene Alias -
Gene Description p21 protein (Cdc42/Rac)-activated kinase 4
Storage Conditions Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/ml
Application Key Func,SDS-PAGE
Immunogen Prot. Seq <u><b>GPHM</b></u>SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRK<u><b>S</u></b>LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 7 ug protein in SDS-PAGE
Storage Buffer In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Gene ID 10298

Más información

Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PAK4 (Human) Recombinant Protein

PAK4 (Human) Recombinant Protein