PAK1 (Human) Recombinant Protein
  • PAK1 (Human) Recombinant Protein

PAK1 (Human) Recombinant Protein

Ref: AB-P5382
PAK1 (Human) Recombinant Protein

Información del producto

Human PAK1 kinase domain (Q13153, 248 a.a. - 545 a.a.) partial recombinant protein expressed in Escherichia coli. The recombinant protein does not have the inhibitory switch domain and has high specific activity.
Información adicional
Size 10 ug
Gene Name PAK1
Gene Alias MGC130000|MGC130001|PAKalpha
Gene Description p21 protein (Cdc42/Rac)-activated kinase 1
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/ml
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPHMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR
Form Liquid
Antigen species Target species Human
Quality control testing Loading 8 ug protein in SDS-PAGE
Storage Buffer In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Gene ID 5058

Enviar un mensaje


PAK1 (Human) Recombinant Protein

PAK1 (Human) Recombinant Protein