Ver mas grande
Ifng (Rat) Recombinant Protein
AB-P5152
Producto nuevo
Ifng (Rat) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Ifng |
| Gene Alias | IFNG2 |
| Gene Description | interferon gamma |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from PBS, pH 7.0 |
| Gene ID | 25712 |
Más información
Rat Ifng (P01581) recombinant protein expressed in Escherichia coli.