Ifng (Rat) Recombinant Protein
  • Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein

Ref: AB-P5152
Ifng (Rat) Recombinant Protein

Información del producto

Rat Ifng (P01581) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ifng
Gene Alias IFNG2
Gene Description interferon gamma
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 25712

Enviar un mensaje


Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein