Ifng (Rat) Recombinant Protein Ver mas grande

Ifng (Rat) Recombinant Protein

AB-P5152

Producto nuevo

Ifng (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 ug
Gene Name Ifng
Gene Alias IFNG2
Gene Description interferon gamma
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 25712

Más información

Rat Ifng (P01581) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein