West Nile Virus Pre-M Recombinant Protein Ver mas grande

West Nile Virus Pre-M Recombinant Protein

AB-P5123

Producto nuevo

West Nile Virus Pre-M Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Storage Conditions Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESILRNPGYALE
Form Liquid
Antigen species Target species Viruses
Storage Buffer In 20 mM phosphate buffer, pH 7.5

Más información

West Nile Virus Pre-M partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

West Nile Virus Pre-M Recombinant Protein

West Nile Virus Pre-M Recombinant Protein