NXT2 (Human) Recombinant Protein
  • NXT2 (Human) Recombinant Protein

NXT2 (Human) Recombinant Protein

Ref: AB-P5014
NXT2 (Human) Recombinant Protein

Información del producto

Human NXT2 (NP_061168, 1 a.a. - 197 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name NXT2
Gene Alias P15-2
Gene Description nuclear transport factor 2-like export factor 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 40% glycerol).
Gene ID 55916

Enviar un mensaje


NXT2 (Human) Recombinant Protein

NXT2 (Human) Recombinant Protein