RCN3 (Human) Recombinant Protein
  • RCN3 (Human) Recombinant Protein

RCN3 (Human) Recombinant Protein

Ref: AB-P5013
RCN3 (Human) Recombinant Protein

Información del producto

Human RCN3 (NP_065701, 21 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name RCN3
Gene Alias RLP49
Gene Description reticulocalbin 3, EF-hand calcium binding domain
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFR
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 57333

Enviar un mensaje


RCN3 (Human) Recombinant Protein

RCN3 (Human) Recombinant Protein