Ver mas grande
GPX3 (Human) Recombinant Protein
AB-P5010
Producto nuevo
GPX3 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GPX3 |
| Gene Alias | GPx-P|GSHPx-3|GSHPx-P |
| Gene Description | glutathione peroxidase 3 (plasma) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (40% glycerol, 1 mM DTT, 50 mM Imidazole). |
| Gene ID | 2878 |
Más información
Human GPX3 (NP_002075, 21 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.