tpx (iEscherichia coli/i) Recombinant Protein Ver mas grande

tpx (iEscherichia coli/i) Recombinant Protein

AB-P5007

Producto nuevo

tpx (Escherichia coli) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name tpx
Gene Alias ECK1320|JW1317|yzzJ
Gene Description lipid hydroperoxide peroxidase
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 945880

Más información

Escherichia coli tpx (NP_415840, 1 a.a. - 168 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

tpx (iEscherichia coli/i) Recombinant Protein

tpx (iEscherichia coli/i) Recombinant Protein