tpx (iEscherichia coli/i) Recombinant Protein
  • tpx (iEscherichia coli/i) Recombinant Protein

tpx (iEscherichia coli/i) Recombinant Protein

Ref: AB-P5007
tpx (Escherichia coli) Recombinant Protein

Información del producto

Escherichia coli tpx (NP_415840, 1 a.a. - 168 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name tpx
Gene Alias ECK1320|JW1317|yzzJ
Gene Description lipid hydroperoxide peroxidase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 945880

Enviar un mensaje


tpx (iEscherichia coli/i) Recombinant Protein

tpx (iEscherichia coli/i) Recombinant Protein