Ver mas grande
deoC (iEscherichia coli/i) Recombinant Protein
AB-P4996
Producto nuevo
deoC (Escherichia coli) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | deoC |
| Gene Alias | ECK4373|JW4344|dra|thyR|tlr |
| Gene Description | 2-deoxyribose-5-phosphate aldolase, NAD(P)-linked |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRF |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (2 mM DTT, 10% glycerol). |
| Gene ID | 948902 |
Más información
Escherichia coli deoC (NP_418798, 1 a.a. - 259 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.