Trl (Fruit fly) Recombinant Protein
  • Trl (Fruit fly) Recombinant Protein

Trl (Fruit fly) Recombinant Protein

Ref: AB-P4986
Trl (Fruit fly) Recombinant Protein

Información del producto

Fruit fly Trl (NP_996080, 1 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Trl
Gene Alias Adf-2|Adf-2-519|Adf2|CG33261|CG9343|E(var)3-trl|E(var)62|GAF|GAGA|NC70F|TfGAGA/Adf-2|Trl-GAGA|anon-EST:fe2E12|l(3)s2325|unnamed
Gene Description Trithorax-like
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
Form Liquid
Antigen species Target species Fruit fly
Quality control testing Loading 3 ug protein in 14% SDS-PAGE
Storage Buffer In 10 mM HEPES, 25 mM NaCl, pH 7.4.
Gene ID 2768981

Enviar un mensaje


Trl (Fruit fly) Recombinant Protein

Trl (Fruit fly) Recombinant Protein