Ver mas grande
Trl (Fruit fly) Recombinant Protein
AB-P4986
Producto nuevo
Trl (Fruit fly) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Trl |
| Gene Alias | Adf-2|Adf-2-519|Adf2|CG33261|CG9343|E(var)3-trl|E(var)62|GAF|GAGA|NC70F|TfGAGA/Adf-2|Trl-GAGA|anon-EST:fe2E12|l(3)s2325|unnamed |
| Gene Description | Trithorax-like |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH |
| Form | Liquid |
| Antigen species Target species | Fruit fly |
| Quality control testing | Loading 3 ug protein in 14% SDS-PAGE |
| Storage Buffer | In 10 mM HEPES, 25 mM NaCl, pH 7.4. |
| Gene ID | 2768981 |
Más información
Fruit fly Trl (NP_996080, 1 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli.